HCV1b (R155Q), FLAG-His-tags

Catalog #: 80104
Size: 20 µg
$405
Species: Human
Host Species: E. coli
MW: 22.3 kDa
Genbank #: AF054247
Tag(s): N-terminal FLAG-His-tags
a.a: 21–32 of NS4A, linker (4 a.a.) and a.a. 3–181 of NS3
Description:
Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) with Arg-to-Gln mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.
UniProt
O92972
Synonym(s):
hepatitis c virus genotype 1b Q155
Formulation:
40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 335 mM imidazole, and 20% glycerol.
Format:
Aqueous buffer solution
Storage / Stability:

>6 months at –80°C.

Application(s):
Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Reference(s):
1. Lin, C., et al., Hepatitis C Viruse. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Lang Kuhs, K.A., et al., Mol. Ther. 2012 May;20(3):669-678.
3. Massariol, MJ., et al., Biochem Biophys Res Commun. 2010 Jan 1;391(1):692-697.
Warning(s):
Avoid freeze/thaw cycles
Amino Acid Sequence:
MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFQAAVCTRGVAKAVDFIPVESMETTMRS
Scientific Category:
Protease
Product Type:
Recombinant Protein
Data shown is lot-specific. Contact us for specific information on other lots.

Quality Assurance

Product Datasheets

80104_Lot130829-1.pdf