HCV1a, FLAG-His-tags

Catalog #: 80010
Size: 20 µg
$405
Species: Human
Host Species: E. coli
MW: 22.4 kDa
Genbank #: NC_004102
Tag(s): N-terminal FLAG-His-tags
a.a: 21–32 of NS4A, linker (4 a.a.) and a.a. 3–181 of NS3
Description:
Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a (HCV1a), GenBank Accession No. NC_004102, with Nterminal FLAG-His tag, MW = 22.4 kDa, expressed in an E. coli expression system.
UniProt
P27958
Synonym(s):
hepatitis c virus genotype 1a
Formulation:
40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol, and 250 mM imidazole.
Format:
Aqueous buffer solution
Storage / Stability:

>6 months at –80°C.

Application(s):
Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Reference(s):
1. Lin, C., et al., Hepatitis C Virus. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Prabhu, R., et al., Exp Mol Pathol. 2004 Jun;76(3):242-52.
Warning(s):
Avoid freeze/thaw cycles
Amino Acid Sequence:
MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVE
GEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQ
GSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAG
HAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Scientific Category:
Protease
Product Type:
Recombinant Protein
Data shown is lot-specific. Contact us for specific information on other lots.

Quality Assurance

Product Datasheets

80010_Lot131112-G1.pdf