NLRP3 (NALP3), His-FLAG-tags (Sf9-derived)

Catalog #: 80117
Size: 5 µg
$455
Species: Human
Host Species: Sf9 insect cells
MW: 120 kDa (calculated)
Genbank #: NM_004895
Tag(s): N-terminal His-FLAG-tags
a.a: 2-1036(end)
Description:
Human NLR Family Pyrin Domain Containing 3 (NLRP3), also known as NALP3, Cold Autoinflammatory Syndrome 1 Protein (CIAS1), cryopyrin and PYPAF1 (Genbank Accession No. NM_004895), a.a. 2-1036(end) with N-terminal His-FLAG-tag, expressed in a baculovirus infected Sf9 cell expression system. MW = 120 kDa (calculated).
UniProt
Q96P20
Synonym(s):
NLRP3, CIAS1, cryopyrin, PYPAF1, NLR Family Pyrin Domain Containing 3, Cold Autoinflammatory Syndrome 1 Protein, NALP3
Purity:

≥50%

Supplied As:
aqueous buffer solution
Formulation:
40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, and 20% glycerol
Format:
Aqueous buffer solution
Storage / Stability:
>6 months at –80°C
Application(s):
Useful for protein binding studies, screening inhibitors of protein-protein interactions, and studying protein function.
Warning(s):
Avoid freeze/thaw cycles
Amino Acid Sequence:
MHHHHHHDYKDDDDKKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLP
RGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDN
ARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNA
RLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFDPDDE
HSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSL
GDLIMSCCPDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDIL
LSSLIRKKLLPEASLLITTRPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEA
QARAAFSLIQENEVLFTMCFIPLVCWIVCTGLKQQMESGKSLAQTSKTTTAVYVFFLS
SLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLR
MNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTVLL
ENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQQIRLELLKWIEVKAKAKKL
QIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESL
SLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSV
LSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVL
SSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVL
STSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVL
STNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLT
SSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQ
EEKPELTVVFEPSW
Scientific Category:
Apoptosis
Product Type:
Recombinant Protein
Data shown is lot-specific. Contact us for specific information on other lots.

Quality Assurance

Product Datasheets

80117.pdf